NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BLZ4_1083996

Scaffold BLZ4_1083996


Overview

Basic Information
Taxon OID3300003317 Open in IMG/M
Scaffold IDBLZ4_1083996 Open in IMG/M
Source Dataset NameBelize BBD 4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)645
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Cnidaria → Cnidaria Microbial Communities From The Caribbean, With Black Band Disease

Source Dataset Sampling Location
Location NameBelize: Carrie Bow Cay Field Station
CoordinatesLat. (o)16.80288Long. (o)-88.08213Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005840Metagenome / Metatranscriptome388Y

Sequences

Protein IDFamilyRBSSequence
BLZ4_10839961F005840N/AVFFAGHTVATVTYCVTKMITTCSPMIGQIFNNIIVASSDTE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.