NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold rootH2_10075090

Scaffold rootH2_10075090


Overview

Basic Information
Taxon OID3300003320 Open in IMG/M
Scaffold IDrootH2_10075090 Open in IMG/M
Source Dataset NameSugarcane root Sample H2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3207
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location
Location NameAyr, Queensland Australia
CoordinatesLat. (o)-19.733298Long. (o)147.17873Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044005Metagenome / Metatranscriptome155Y
F047908Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
rootH2_100750902F047908AGGAGMELEDALNLGLPPHHVSQCSTGERVAFRAEILGYPQCTGFGATADEAVRVARHLFTQLRDGQAAVAVTDLERDNAERLREAMRFVVTRALV*
rootH2_100750904F044005AGGMDDITEAPAMPLGTAGTRSKPIGLIVVLLLALAAAGWLGFYAQTLVEERAHMRVEIAAQERKILDLREQLTRAEVAIQEKDAALATRDVALADATQPELPVRVSFRPAWMGQGMVASFRNVGTQQLTLMVEFRDSNLKTSRDFALVVEAGASAEVGHPQGWLVSSGQSVRVSASGFKSVTAFAP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.