NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold rootH1_10277836

Scaffold rootH1_10277836


Overview

Basic Information
Taxon OID3300003323 Open in IMG/M
Scaffold IDrootH1_10277836 Open in IMG/M
Source Dataset NameSugarcane root Sample H1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1016
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location
Location NameAyr, Queensland Australia
CoordinatesLat. (o)-19.733298Long. (o)147.17873Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027546Metagenome / Metatranscriptome194Y

Sequences

Protein IDFamilyRBSSequence
rootH1_102778363F027546GGAGGMKTAGEPDPVPWKPLGERVQPMKPQAPEWQPLAHAPHIEANRQGQLRTNLPLPK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.