Scaffold GBSed_10002722

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GBSed_10002722

Scaffold GBSed_10002722

Overview

Basic Information
Taxon OID	3300003332 Open in IMG/M
Scaffold ID	GBSed_10002722 Open in IMG/M
Source Dataset Name	Marine hydrothermal vent sediment microbial communities from Guaymas Basin, Gulf of California - Sample 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12063
Total Scaffold Genes	18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	13 (72.22%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent Sediment → Marine Hydrothermal Vent Sediment Microbial Communities From Guaymas Basin, Gulf Of California

Source Dataset Sampling Location
Location Name	Guyams Basin, Gulf of California, Pacific Ocean
Coordinates	Lat. (^o)	27.01	Long. (^o)	-111.43	Alt. (m)		Depth (m)	2000
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008290	Metagenome	335	Y

Sequences

Protein ID	Family	RBS	Sequence
GBSed_1000272213	F008290	AGG	MPEKIRMKISRASYVQRVGNKDYIKTRSRIESVPMRKLAKMNSLGGRTWRLVQEGRDIFLVLEALTLEEEKEALKKG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.