Scaffold GBSed_10060067

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GBSed_10060067

Scaffold GBSed_10060067

Overview

Basic Information
Taxon OID	3300003332 Open in IMG/M
Scaffold ID	GBSed_10060067 Open in IMG/M
Source Dataset Name	Marine hydrothermal vent sediment microbial communities from Guaymas Basin, Gulf of California - Sample 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1275
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent Sediment → Marine Hydrothermal Vent Sediment Microbial Communities From Guaymas Basin, Gulf Of California

Source Dataset Sampling Location
Location Name	Guyams Basin, Gulf of California, Pacific Ocean
Coordinates	Lat. (^o)	27.01	Long. (^o)	-111.43	Alt. (m)		Depth (m)	2000
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028993	Metagenome	189	N

Sequences

Protein ID	Family	RBS	Sequence
GBSed_100600671	F028993	N/A	MADIVEKAVKKRSERIAVSEAYYKEGVEHPTKDWLEEFKKAKDRRNAGLRRAMEEGLFEIGAERVGTDGWQKATLAKADRWLSGATSAEANEKYESAMRDVAECIERARKAVEGMPTTTVEQRAEKSKRFQIEMAKCMEEKRKRR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.