Scaffold JGI26470J50227_1001988

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI26470J50227_1001988

Scaffold JGI26470J50227_1001988

Overview

Basic Information
Taxon OID	3300003375 Open in IMG/M
Scaffold ID	JGI26470J50227_1001988 Open in IMG/M
Source Dataset Name	Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6853
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (69.23%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany

Source Dataset Sampling Location
Location Name	Trout Bog Lake, Wisconsin, USA
Coordinates	Lat. (^o)	46.0409	Long. (^o)	-89.686	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082043	Metagenome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI26470J50227_10019884	F082043	GGA	MAESFSYKITTESEVFTFDFSQVLLESETILTATCIAIVMNGVDNNPSAIVIGTPVIFNKTASQRIANGVSEVTYRLEMTITTSLGNTYVGVGDLDIYSADLV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.