Scaffold JGI25920J50251_10017567

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI25920J50251_10017567

Scaffold JGI25920J50251_10017567

Overview

Basic Information
Taxon OID	3300003404 Open in IMG/M
Scaffold ID	JGI25920J50251_10017567 Open in IMG/M
Source Dataset Name	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2324
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location Name	Lake Michigan, USA
Coordinates	Lat. (^o)	43.1998	Long. (^o)	-86.5698	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030434	Metagenome	185	N

Sequences

Protein ID	Family	RBS	Sequence
JGI25920J50251_100175673	F030434	GAGG	MQTNMAITEMAQIVQVILDRSQELQAAASGFARSTGEKANTPDHAGRYNTKINFHEFVAEHSEAAGAEIAVAQYMGIRNFIPTVNTFHDAPDIQLGNLGFEVKWTKYINGHLIIHKDYPRLSDVAILVVNKSPVYQIIGWMPVLWAKKAKYYNAADGNFWVSQRELFEMDALRKSVYGINEN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.