NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25911J50253_10012722

Scaffold JGI25911J50253_10012722


Overview

Basic Information
Taxon OID3300003411 Open in IMG/M
Scaffold IDJGI25911J50253_10012722 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3190
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007363Metagenome / Metatranscriptome352Y
F024549Metagenome / Metatranscriptome205Y
F097310Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
JGI25911J50253_100127221F007363AGGTGGMKNYSIADLLVDQYYSPNSVSRRFNGGIINHAEKRENVWAGNNNQVFAIRYRPTGSLNDNWATVSVRTED*
JGI25911J50253_100127226F097310GGAMGKMKELFTEIINCDLCNGKGWLFAGNAIDXDVESCECNPKELEVNY*
JGI25911J50253_100127227F024549GGAMYRLDTYYDGNLEYTFQFADPLQAFEAFAKCYDVGFAKEXATYNLSMPTGKMYTKNFNRIGLVSAK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.