NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25922J50271_10010824

Scaffold JGI25922J50271_10010824


Overview

Basic Information
Taxon OID3300003413 Open in IMG/M
Scaffold IDJGI25922J50271_10010824 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2454
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (30.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008688Metagenome / Metatranscriptome329N
F009135Metagenome / Metatranscriptome322Y
F013524Metagenome / Metatranscriptome270Y
F024047Metagenome / Metatranscriptome207N

Sequences

Protein IDFamilyRBSSequence
JGI25922J50271_100108243F024047GGAMTIVKTSEIIEWVKNAVEKKMIKELNIPNAKVYLSCDRPNPDVILETKNADGDLQIVRFLVI*
JGI25922J50271_100108245F009135N/AMNKPKYYLTVNLPPNFDDLDAEIIKKDLITYINSRNQWGALYGPKSSKKGITIDKVIYRTNED*
JGI25922J50271_100108246F013524N/AMKTNKEVVNRLKEFTSNNCNTTLDPKLCEDIRYLCDEVERFGREIVKANDHMDEDFITIQRYKNKLSKYESF*
JGI25922J50271_100108247F008688N/AMNRFNKIMLGSLAAILLTAMTVEPPKIKVYLIMSYRSSDLTIEKVYLKKENAEKYRDMYKESHNYSVEERELTE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.