NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold KH04B_1254168

Scaffold KH04B_1254168


Overview

Basic Information
Taxon OID3300003456 Open in IMG/M
Scaffold IDKH04B_1254168 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S17-KH04B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)529
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Alkalihalobacillus → Alkalihalobacillus bogoriensis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading

Source Dataset Sampling Location
Location NameDouglas Channel, British Columbia, Canada
CoordinatesLat. (o)53.6667Long. (o)-129.1333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096595Metagenome104Y

Sequences

Protein IDFamilyRBSSequence
KH04B_12541681F096595AGCAGMRNGNTMDSIIKFGQFVRQQRQQNGWTQLQLSLKVFDKPNLEYIGRLERGKLAGITFTTADKIMDALGSELQFEVGEKYIPDLHKSSFRF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.