Scaffold NAP4_1007679

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold NAP4_1007679

Scaffold NAP4_1007679

Overview

Basic Information
Taxon OID	3300003474 Open in IMG/M
Scaffold ID	NAP4_1007679 Open in IMG/M
Source Dataset Name	Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1824
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine → Estuary Microbial Community From Gulf Of Naples, Italy

Source Dataset Sampling Location
Location Name	Sarno river estuary, Gulf of Naples
Coordinates	Lat. (^o)	40.72683	Long. (^o)	14.46133	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074909	Metagenome / Metatranscriptome	119	N

Sequences

Protein ID	Family	RBS	Sequence
NAP4_10076792	F074909	AGGA	MAVNPNIEPHGVTDDPIVNEVIELIVKRHLQGMEKFGKTMSANERPINEWVDETIEELLDAIHYLVKTKTIFDKFKADNKRLKAALEAFEKESFVNDKKEEGS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.