Scaffold SACTD2sed_1000472

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SACTD2sed_1000472

Scaffold SACTD2sed_1000472

Overview

Basic Information
Taxon OID	3300003512 Open in IMG/M
Scaffold ID	SACTD2sed_1000472 Open in IMG/M
Source Dataset Name	Macrotidal river microbial communities from the South Alligator River system, Northern Australia - Sample CTD2 sed R1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3223
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (53.85%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Macrotidal River → Macrotidal River Microbial Communities From The South Alligator River System, Northern Australia

Source Dataset Sampling Location
Location Name	River
Coordinates	Lat. (^o)	-12.2376	Long. (^o)	132.4096	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053258	Metagenome / Metatranscriptome	141	N

Sequences

Protein ID	Family	RBS	Sequence
SACTD2sed_100047213	F053258	GAG	MNLTNEQTELLIDAIWKRQHHFIAGDRRYREYGXEASLPYKYTRDEFK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.