NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SACTD2sed_1001295

Scaffold SACTD2sed_1001295


Overview

Basic Information
Taxon OID3300003512 Open in IMG/M
Scaffold IDSACTD2sed_1001295 Open in IMG/M
Source Dataset NameMacrotidal river microbial communities from the South Alligator River system, Northern Australia - Sample CTD2 sed R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2406
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Macrotidal River → Macrotidal River Microbial Communities From The South Alligator River System, Northern Australia

Source Dataset Sampling Location
Location NameRiver
CoordinatesLat. (o)-12.2376Long. (o)132.4096Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002197Metagenome / Metatranscriptome584Y
F002907Metagenome / Metatranscriptome521Y
F030378Metagenome / Metatranscriptome185Y
F046343Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
SACTD2sed_10012952F046343N/AMTLKKTGTEVLTKDEMKELIALKEAITYDPHTVSAQKMEKFAELMVRSLEGKESNAPQ*
SACTD2sed_10012954F002197GGAMYSLKILAPFLAAMCLEGATTGQGDYCVVDNNPPSVVKYYETGKSCYVNGTFYSKCEDRLNGSI*
SACTD2sed_10012955F030378AGGAMTNEYLSSDFSYKKYSLEQLDNWVNDALNCEDLTPQDIYDTVIKCVDESVEYHKKYLTKSIELLSLLKGHRPNVFDASAHEFNDFWYEQDKISQHYSEEDLNAMCDAAADKEKCREYNLXRKQVVMSGRLECNV*
SACTD2sed_10012958F002907GGAGGVKINPYSIFMKWRIDEPTPLEILAEKVQQLEDKVRVLEECNVEQTNALYECWNSLDARIDILAEYKTDV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.