Scaffold SACTD2sed_1004791

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SACTD2sed_1004791

Scaffold SACTD2sed_1004791

Overview

Basic Information
Taxon OID	3300003512 Open in IMG/M
Scaffold ID	SACTD2sed_1004791 Open in IMG/M
Source Dataset Name	Macrotidal river microbial communities from the South Alligator River system, Northern Australia - Sample CTD2 sed R1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2403
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Macrotidal River → Macrotidal River Microbial Communities From The South Alligator River System, Northern Australia

Source Dataset Sampling Location
Location Name	River
Coordinates	Lat. (^o)	-12.2376	Long. (^o)	132.4096	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002564	Metagenome / Metatranscriptome	547	Y

Sequences

Protein ID	Family	RBS	Sequence
SACTD2sed_10047912	F002564	N/A	MALTIDRGTNLVEYHESTPLTALNDSLEIHADSSEFTFAAVVTGGANFTLALETNFNGGAEWFTIDTSKTINADGQYVYFYTGKPCNRIRMRIESISSGTPNVVPHIGVAYHG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.