NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ba1_1028087

Scaffold Ba1_1028087


Overview

Basic Information
Taxon OID3300003535 Open in IMG/M
Scaffold IDBa1_1028087 Open in IMG/M
Source Dataset NamePetroleum reservoir microbial communities from Reconcavo Basin, Brazil, analyzing oil degradation - Bahia-well BA- 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)941
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Petroleum Reservoir → Petroleum Reservoir Microbial Communities From Reconcavo Basin, Brazil, Analyzing Oil Degradation

Source Dataset Sampling Location
Location NameBrazil: State of Bahia
CoordinatesLat. (o)-12.2Long. (o)-38.11Alt. (m)Depth (m)500 to 1000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070092Metagenome123N

Sequences

Protein IDFamilyRBSSequence
Ba1_10280871F070092AGGAGMAINDRLKPVMELLETNRQKIGLMISHGMASDLAIERRKKELYHEVMTAKENAFKEELADLEGEIRKIEDSYREPKKDPTTKLLEFEQIKAKIRSTPSKELKELTHKFQNTGAIPGIPWERPDHVDVLVAELRIRGLDEEADLTWDHAYNKLKVDRPWENNPLYKQLKSQHNKVSVLAGFKDMLKFLDGTNNAVYISETLKYKGG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.