Scaffold FS896DNA_10426145

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold FS896DNA_10426145

Scaffold FS896DNA_10426145

Overview

Basic Information
Taxon OID	3300003540 Open in IMG/M
Scaffold ID	FS896DNA_10426145 Open in IMG/M
Source Dataset Name	Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	537
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria → Neisseria gonorrhoeae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location
Location Name	Axial seamount, northeast pacific ocean
Coordinates	Lat. (^o)	45.926575	Long. (^o)	-129.979479	Alt. (m)		Depth (m)	1507
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056069	Metagenome	138	N

Sequences

Protein ID	Family	RBS	Sequence
FS896DNA_104261451	F056069	GGAGG	MIKKSKTVNKRVMQKIVDKLAEGITLTEICQADDMPSYRSITRAVQLDEDLWELYRKGRVQQAEFYTDRINRLAMSPLPDVDDQRKLHAEVNRRKLEIETLKWTTSRNQPHGVRDKKEDAPQQQAITISWAGGDVDVSHGES*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.