Scaffold JGI20214J51650_10061795

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI20214J51650_10061795

Scaffold JGI20214J51650_10061795

Overview

Basic Information
Taxon OID	3300003541 Open in IMG/M
Scaffold ID	JGI20214J51650_10061795 Open in IMG/M
Source Dataset Name	Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2507
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (40.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location
Location Name	Sacramento, California, United States
Coordinates	Lat. (^o)	38.1072	Long. (^o)	-121.6485	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020727	Metagenome / Metatranscriptome	222	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20214J51650_100617952	F020727	GGA	MMKYQVLVKTISGKGGEFWEAFRKMPTEPMKGVMIESSWSLYGYWDFVIFFLADSNENSLHFVGEVLRAIPGIADTSTSPMTILKEHKRQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.