NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FS900DNA_10021665

Scaffold FS900DNA_10021665


Overview

Basic Information
Taxon OID3300003542 Open in IMG/M
Scaffold IDFS900DNA_10021665 Open in IMG/M
Source Dataset NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS900_Dependable_DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2083
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location
Location NameAxial seamount, northeast pacific ocean
CoordinatesLat. (o)45.87992Long. (o)-129.80294Alt. (m)Depth (m)1917
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035492Metagenome172N
F071659Metagenome122Y

Sequences

Protein IDFamilyRBSSequence
FS900DNA_100216653F035492AGGAGMADVGSILESKESQDSWYDPKKDFSGPMPEGEYKAHVKALNIKRNIVVKGKFLSDIYEVTFTVADENKDMEYQNDKGESLSGSAIVGRDFRSKGFFRFKKPNKSEYPNLSENMGSNRSYMELVSSFGLKMEEVDGKFYLPELDSSDIEGLPVIAKLYHDTWTDGDGEDRITPRASMIFDWEDGEKKEEELPF*
FS900DNA_100216655F071659GAGMGWDAGIDAMCEAHREVAPKKPIYELSKREDKKLIFRLRKRYSKYKEGSN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.