Basic Information | |
---|---|
Taxon OID | 3300003572 Open in IMG/M |
Scaffold ID | Ga0007424J51698_1037505 Open in IMG/M |
Source Dataset Name | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Bulk_40 (Metagenome Metatranscriptome, Counting Only) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1230 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Consotaella → Consotaella salsifontis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hopland, California, USA | |||||||
Coordinates | Lat. (o) | 38.972988 | Long. (o) | -123.116539 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F053104 | Metagenome / Metatranscriptome | 141 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0007424J51698_10375051 | F053104 | N/A | GTRPVLREAHMTRFSKMFAVSGLAMATVIGLSWVVASPPTNASTYVAAQIDPDQMTRNAPRDLPSFEQNYQMHTGVLDTLRR* |
⦗Top⦘ |