NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI26464J51801_1011462

Scaffold JGI26464J51801_1011462


Overview

Basic Information
Taxon OID3300003604 Open in IMG/M
Scaffold IDJGI26464J51801_1011462 Open in IMG/M
Source Dataset NameThermal spring microbial communities from Yellowstone National Park, Wyoming, USA - Perpetual Spouter A (PS_A) MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1147
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051572Metagenome / Metatranscriptome144N

Sequences

Protein IDFamilyRBSSequence
JGI26464J51801_10114621F051572GAGGMTSRTHSGPFAEVRTFADIVLEGGCKKSLQFLNAYFDLCVLAVLIKAAPAGPMVRLRPEMVRRLVEEVAAAVGGGDRERIRNAMLKRAGEMMAQLRRELGDSAPSEAYVAKL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.