NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MetavP1_102264

Scaffold MetavP1_102264


Overview

Basic Information
Taxon OID3300003631 Open in IMG/M
Scaffold IDMetavP1_102264 Open in IMG/M
Source Dataset NameHypersaline viral communities from Bras del Port, Santa Pola, Spain - LoValdivia P1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLifesequencing S.L.
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1758
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain

Source Dataset Sampling Location
Location NameBras del Port, Santa Pola, Spain
CoordinatesLat. (o)38.192206Long. (o)-0.591865Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079661Metagenome115Y

Sequences

Protein IDFamilyRBSSequence
MetavP1_1022641F079661N/AVGKALQTIGLPLFEMSQTTIQISEELRDELRNERKSHESNYGDTIERLLDDGTGGQLWTERELKDLIQREIEQVSRR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.