Scaffold MetavP1_104008

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold MetavP1_104008

Scaffold MetavP1_104008

Overview

Basic Information
Taxon OID	3300003631 Open in IMG/M
Scaffold ID	MetavP1_104008 Open in IMG/M
Source Dataset Name	Hypersaline viral communities from Bras del Port, Santa Pola, Spain - LoValdivia P1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Lifesequencing S.L.
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1224
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Haloarculaceae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain

Source Dataset Sampling Location
Location Name	Bras del Port, Santa Pola, Spain
Coordinates	Lat. (^o)	38.192206	Long. (^o)	-0.591865	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066493	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
MetavP1_1040081	F066493	GGTGG	MSEREWDDGLVDVADELVSEYSAEGAIDRLQRRRASTTSDDLADRCVAAIAYIRREVQDDER*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.