NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0005851_1077432

Scaffold Ga0005851_1077432


Overview

Basic Information
Taxon OID3300003684 Open in IMG/M
Scaffold IDGa0005851_1077432 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA - 2 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)921
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameSandusky Bay, Ohio, USA
CoordinatesLat. (o)41.474889Long. (o)-82.854137Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001923Metagenome / Metatranscriptome617Y
F003583Metagenome / Metatranscriptome478Y

Sequences

Protein IDFamilyRBSSequence
Ga0005851_10774322F001923N/AVSAAPFNPEDIPKEVKDGLVASILGGLAMTARLLLSTEPVSLGWVVRRVCAAAITAALVGYAIQEHIQSPGLRMGVVGAAGYAAPECLDYLLKYVKARGEKEVAAVAGKPSKPHGKGKANKPAAKRGK*
Ga0005851_10774323F003583N/AMGKAKPTSQQPSGGSNLVLAVCLLTAFAGLSAFASAYIAGVVLDLLQSRDALVMIVTDAGIKSDSVSVEQGLSAATLALKAVRDLGWALAVGCLGVGVAVFIRSRRQNAS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.