NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold PicViral_1002478

Scaffold PicViral_1002478


Overview

Basic Information
Taxon OID3300003690 Open in IMG/M
Scaffold IDPicViral_1002478 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5071
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (88.24%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Mid Cayman Rise - Piccard2013-Plume

Source Dataset Sampling Location
Location NameMid-Cayman Rise, Caribbean Sea
CoordinatesLat. (o)53.0Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002743Metagenome / Metatranscriptome533Y
F014983Metagenome / Metatranscriptome258Y
F015479Metagenome254Y

Sequences

Protein IDFamilyRBSSequence
PicViral_100247814F002743GGAMNDEDKVYHDLLDHVLHLLEHKLPVMMVAASLMAIAQRLYRTNLNEEDYQRIMKVAYETNVEPYDIKKGTLH*
PicViral_10024787F014983AGGAMVKLFTNEKETKRAVKAAVDQANKVRTHCAGCGCTPKPDEWSTQNKNYCFDCA*
PicViral_10024788F015479AGGMKILMILGTGAILTFPTIDPAFEEVKPDCFSQGYAVLEKLATYHDTGNRDQGWYLNGTKILVAGFYCQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.