Scaffold PicViral_1002977

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold PicViral_1002977

Scaffold PicViral_1002977

Overview

Basic Information
Taxon OID	3300003690 Open in IMG/M
Scaffold ID	PicViral_1002977 Open in IMG/M
Source Dataset Name	Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Michigan
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4524
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Candidatus Omnitrophica bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Mid Cayman Rise - Piccard2013-Plume

Source Dataset Sampling Location
Location Name	Mid-Cayman Rise, Caribbean Sea
Coordinates	Lat. (^o)	53.0	Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054156	Metagenome / Metatranscriptome	140	N

Sequences

Protein ID	Family	RBS	Sequence
PicViral_10029775	F054156	AGG	LLEALLLTGEIPEIRWEHGDDLCDCTFQRIGYWTNPYLARTTEIRICCVWKVMVEQNPEIAALVREIPAFDDYNKDRWVTEPAPWDSEDGDMPRALWHRQLSVQQGKPLEQVRKEYDHLEPPRRLPKKTPSVRLTRPKKVLR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.