NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold PicViral_1003081

Scaffold PicViral_1003081


Overview

Basic Information
Taxon OID3300003690 Open in IMG/M
Scaffold IDPicViral_1003081 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5627
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (91.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Mid Cayman Rise - Piccard2013-Plume

Source Dataset Sampling Location
Location NameMid-Cayman Rise, Caribbean Sea
CoordinatesLat. (o)53.0Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038405Metagenome / Metatranscriptome166Y
F039339Metagenome164Y

Sequences

Protein IDFamilyRBSSequence
PicViral_100308111F038405GAGGMRISGQTLNQLRPLLTKALEDGAEVSFMYHDKRRNGPLKDFGWGPQGPFITIEHKKYSLGLQDQNELLENGSTKPGYQTEIKSFSLAKMSELRIERFVVV*
PicViral_100308112F039339N/AVASGMRLVLEKRQHTDSDGIVYRYSLYDNNDFVEDFFETLAQAWSYIYYYEDEEMRV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.