NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold PicViral_1007156

Scaffold PicViral_1007156


Overview

Basic Information
Taxon OID3300003690 Open in IMG/M
Scaffold IDPicViral_1007156 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4007
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Mid Cayman Rise - Piccard2013-Plume

Source Dataset Sampling Location
Location NameMid-Cayman Rise, Caribbean Sea
CoordinatesLat. (o)53.0Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025390Metagenome / Metatranscriptome202N
F026127Metagenome / Metatranscriptome199Y

Sequences

Protein IDFamilyRBSSequence
PicViral_10071562F025390AGGAGMTTHFKMPDRFPVTSTQGGGYDFLGQTSYMDDFYSFITRTNTSNNGRGSPGWYVSQTASTQTCQPDADAHGGWLQLDEVNATNDAYNQVNTFTAFQLSTKMNSGFECRIAVEDVSTTEMVIGLVDTDVTSGTVDITDGVYFSNFADPTSITAGTGWYLHAEKNGTVTSSSALVDPYTGDTFVIEDGSLQAASATQLATPSNSFIFGFNIVPQGSNGNVNTAVIQSYLGPVGKQPMAAESIATTNLPDDLALGIMIGTKNNTTTASIMWVDYIKMISSRGFGSSTTL*
PicViral_10071564F026127GGAMFSMAIISALNMYGCVYQGMSMKPHKTSVTTTYGQDEVDKANDSKDQTKDSMQITVKQEFLWEE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.