Scaffold JT63_1027053

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JT63_1027053

Scaffold JT63_1027053

Overview

Basic Information
Taxon OID	3300003691 Open in IMG/M
Scaffold ID	JT63_1027053 Open in IMG/M
Source Dataset Name	Combined assembly of microbial communities in oil-polluted sediment from the Gulf of Mexico
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Argonne National Laboratory
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	2625
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Marine Sediment → Oil-Polluted Seafloor Microbial Communities From The Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Gulf of Mexico, USA
Coordinates	Lat. (^o)	28.74511	Long. (^o)	-88.35914	Alt. (m)		Depth (m)	0 to .01
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025922	Metagenome / Metatranscriptome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
JT63_10270534	F025922	AGGAG	MARNRIIYASQSVWCNGDLLYRVQSLGSTTTFTSEDIFELGHLDIIDVVDDVPSVAVTLNTNDFGDVTTFATLAQVLPARRAMDATASISNSNLEVVDASLTGIGTYLHGVCVPDFAIACGALPGVSIWAPVQEECSLGSLADNI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.