NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0040879_107197

Scaffold Ga0040879_107197


Overview

Basic Information
Taxon OID3300003730 Open in IMG/M
Scaffold IDGa0040879_107197 Open in IMG/M
Source Dataset NameThermal spring microbial communities from Beowulf Spring, Yellowstone National Park, Wyoming, USA - Beowulf (BE_D) (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)698
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042426Metagenome / Metatranscriptome158N
F061049Metagenome / Metatranscriptome132Y
F063847Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0040879_1071971F042426N/AGNVKRLMDLPLKSIYTIGQGETKSGFEVYYLFEYKSGNFSEKADNVYMIYSTTVLGEWLTENFDKLKKAIFELEIEFRDSQYNKKIAVPVRVKKIGDKPRAPVQVQEEGF*
Ga0040879_1071972F061049N/AMSIFIIRFEKDNSVIREWVFEGNEDLERSLIEMLDIDFQFINKIRGLEK*
Ga0040879_1071973F063847AGGGGGMRFKKYIFCYDQYSYLQDKVITHHVSIYAKSLREAESKLEKLGYKDLYLKKKKRKVNY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.