Scaffold Ga0062515_10187

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0062515_10187

Scaffold Ga0062515_10187

Overview

Basic Information
Taxon OID	3300003742 Open in IMG/M
Scaffold ID	Ga0062515_10187 Open in IMG/M
Source Dataset Name	Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_80_13L
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	The Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1203
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location
Location Name	Marker 33 diffuse flow vent, Axial Seamount
Coordinates	Lat. (^o)	45.9332	Long. (^o)	-129.982268	Alt. (m)		Depth (m)	1516
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082613	Metagenome / Metatranscriptome	113	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0062515_101872	F082613	AGG	MRPCHYSYTPEAAATNSISLSQAVVGAAALTQTGTYGVNGFPSELAWNITITSSANISGVNLTIVYLDAQLNQQSIVVAGPNATTKDAGIYATKIISVTTSASDSNILIGHTNVGFAPWKVIPSRGVSSTTGASIGIDGTANITLQTTFANIADNAIFAGTFDVFSHSYLAALTASAFDTVDTREIGVRLKFNSWSSGNVRLDLSVSAKG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.