Scaffold Ga0064031_11234

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0064031_11234

Scaffold Ga0064031_11234

Overview

Basic Information
Taxon OID	3300003948 Open in IMG/M
Scaffold ID	Ga0064031_11234 Open in IMG/M
Source Dataset Name	Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS907_80_12L9
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	573
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location
Location Name	Anemone diffuse flow vent, Axial seamount
Coordinates	Lat. (^o)	45.933	Long. (^o)	-130.014	Alt. (m)		Depth (m)	1542
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042865	Metagenome / Metatranscriptome	157	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0064031_112341	F042865	AGGCGG	MALRVPDYETFLAADDFNKRIWWSFMQSVVNDLPLNGNVAPENIVRANKSCLYVESTGGTAVLWFNPNGNGSATGWIVK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.