NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063037_106685

Scaffold Ga0063037_106685


Overview

Basic Information
Taxon OID3300003979 Open in IMG/M
Scaffold IDGa0063037_106685 Open in IMG/M
Source Dataset NameDiffuse hydrothermal vent microbial communities from Menez Gwen hydrothermal field, Mid Atlantic ridge - MGW_B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMax Planck Institute for Plant Breeding Research
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2893
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Vent → Diffuse Hydrothermal Vent Microbial Communities From Menez Gwen Hydrothermal Field, Mid Atlantic Ridge

Source Dataset Sampling Location
Location NameMid-Atlantic Ridge
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007121Metagenome / Metatranscriptome357Y
F025588Metagenome / Metatranscriptome201N

Sequences

Protein IDFamilyRBSSequence
Ga0063037_1066851F007121N/AMLLLFGFTTPTSGGWQIVLQDELQEPTLDKLIDWVPEEVPRTVSFYFDTDADGKFDIKIAYSLIEAFPCRQNCVSRITDNGDHWLLPAPGINYYVIKKWIVYRYVDDEDWRGEYKTQQ
Ga0063037_1066857F025588N/AMKTYDKFKKELTEDGMLHGEPGDENPSTTIHYSPNDPEIVRTASVTMTVPKYRLSESEKGCNHTCAHWRDSSWCNEYYFKCDSTYTCDSWKDSGI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.