Scaffold Ga0065183_10178256

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0065183_10178256

Scaffold Ga0065183_10178256

Overview

Basic Information
Taxon OID	3300004113 Open in IMG/M
Scaffold ID	Ga0065183_10178256 Open in IMG/M
Source Dataset Name	Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	888
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location Name	Helgoland, North Sea, Atlantic Ocean
Coordinates	Lat. (^o)	53.9944	Long. (^o)	6.8905	Alt. (m)		Depth (m)	29
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082711	Metagenome / Metatranscriptome	113	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0065183_101782563	F082711	N/A	MRTIELKRKLDGRTFRGRVPCSESKKRPELGPLIDYHDLGVFEGKVVQSIFAKKLRGPESFGFCRKFCAMSMQAVADLLQVDRRTVQRWESEESPVPPWAMLLVAKMADERSKGR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.