NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0062593_100039309

Scaffold Ga0062593_100039309


Overview

Basic Information
Taxon OID3300004114 Open in IMG/M
Scaffold IDGa0062593_100039309 Open in IMG/M
Source Dataset NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2814
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location NameWisconsin, United States
CoordinatesLat. (o)43.2958Long. (o)-89.3799Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009894Metagenome / Metatranscriptome311Y
F023112Metagenome211Y

Sequences

Protein IDFamilyRBSSequence
Ga0062593_1000393092F009894N/AMRPGPLRSIVVGFALVAGCLPARSVYAQQTPAIEIALPRQLVRGQTTVVHVAIPSREVFQGAEVSPAAGVTVAGVSNLKRSELSQNVAWWDVTLNVATDAAPGPRSLVLLLPTGRTTAATLVIPNHVPAIADLRVASATPQRVDVQFGATDQSADLGNLPYVWFTIACGGEPTVGVVRGRAMGATVSASIPRPAAAACDLEVRASDTQKNDSNTLKTRVQ*
Ga0062593_1000393093F023112AGGMLLLATVLLSVGLSLAISRIFLGCVLHVMTHGGLPAFHWRPVIFVTALFWMWYLTPAIAASHAATRVIQLLLH*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.