NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0062593_100424122

Scaffold Ga0062593_100424122


Overview

Basic Information
Taxon OID3300004114 Open in IMG/M
Scaffold IDGa0062593_100424122 Open in IMG/M
Source Dataset NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1200
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location NameWisconsin, United States
CoordinatesLat. (o)43.2958Long. (o)-89.3799Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013837Metagenome / Metatranscriptome268Y
F050357Metagenome / Metatranscriptome145N

Sequences

Protein IDFamilyRBSSequence
Ga0062593_1004241221F050357N/ACWISRAERNEPVEGIRLWRANRQKLVGMVYLDKGVLDLDIQDDHERALLEEVFEQTGQVTWSFSRFDEGEWQESIAEPRTDRWLWFVVANILYPMGYQADLGADKDGEPTRSP*
Ga0062593_1004241223F013837GGAGMTTLTDTVRIEAPTRASIKQAASLDASRDTASGSRAPEQWFEVESRGGYARTVVGRIAYFDDEAQTYMVLTRAGMLVRVPLRDITSSSSVTSGRPTVRAALSKLSRLRDATTVSPP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.