Scaffold Ga0066604_10466556

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066604_10466556

Scaffold Ga0066604_10466556

Overview

Basic Information
Taxon OID	3300004241 Open in IMG/M
Scaffold ID	Ga0066604_10466556 Open in IMG/M
Source Dataset Name	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	507
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater → Freshwater Pond Sediment Microbial Communities From The University Of Edinburgh, Under Environmental Carbon Perturbations

Source Dataset Sampling Location
Location Name	Crawford Collection of the Royal Observatory Edinburgh
Coordinates	Lat. (^o)	55.9225	Long. (^o)	-3.1724	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102133	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066604_104665561	F102133	AGGAGG	MGEHLKTAALFLIAAGLFMMSFVIHDVMGKHSRYEPVSYDDEQVVVMDTHTGEVWSVDYEARQTASLKIFNPIAGELQIFPKKLSARVGK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.