NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066606_10012968

Scaffold Ga0066606_10012968


Overview

Basic Information
Taxon OID3300004280 Open in IMG/M
Scaffold IDGa0066606_10012968 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3914
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameBritish Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027831Metagenome193Y
F056357Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0066606_100129683F027831N/AVARGKQSGIAFGQRTKQKGQSDLEQLIMLKQFLKQRFHMDFKREWYVGFDKEYGNLYRISESVGKQELSEFKWKNPDLLCFDNQHGIIIVELDGAIHDRKVQKTIERNELFRGAGIKLVVLNIADIKEVGETIIGRLESDMMDLIHGQKI*
Ga0066606_100129685F056357N/ALTDHTSMITKTLALVALLTMSVTLAHAETSTVEVPFDSHGQSCWYDDLAVEYHCTWQGVVETFTIEDLEEFRDILDETIYNEELKRLQETALAEIAEEKAILSPNEKTILAIENKLNQGIATASDSVLMNLLKELNTCRQGMDERTQHVQTAREFEISDFELWSANNVKYDGPIGKIVMAIEECQAQEHVYKLSVGYQNFDFGSKQYSLADKFTPDIQAVNYDSLVATDSGINKSLICDSNQHSQQYKKQFGCLVLYDGLDAEEIKRQNETRFGTDGKISYESQVLTDYMDFLSNYGSRQATVEDKKVQEEIALPIANEWKEDHNFYNNHKGLE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.