NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066227_1000054

Scaffold Ga0066227_1000054


Overview

Basic Information
Taxon OID3300004338 Open in IMG/M
Scaffold IDGa0066227_1000054 Open in IMG/M
Source Dataset NameSediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC1A
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2672
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales → Atkinsviridae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Sediment → Metatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil

Source Dataset Sampling Location
Location NameSao Paulo State, Brazil
CoordinatesLat. (o)-23.8553Long. (o)-46.1394Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014988Metagenome / Metatranscriptome258Y

Sequences

Protein IDFamilyRBSSequence
Ga0066227_10000542F014988GGAGMAITVSSPVTGAAITGLSSPTYTLVTDTAPGAGKQYAVTALGGTQTGVEAHSVSKPFTLSAFRPGTLRVLPGANPVTGVIKNVPVNTYKVITRKGAAPAANQPNVVARVTTVLDIPAGTDSYSPAELKAMLSLHFGALTDMADGIADTALTGIL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.