NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0064592_1176650

Scaffold Ga0064592_1176650


Overview

Basic Information
Taxon OID3300004454 Open in IMG/M
Scaffold IDGa0064592_1176650 Open in IMG/M
Source Dataset NameStalagmite microbial communities from Echo Passage, Kartchner Caverns, Arizona, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2441
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Stalagmite → Stalagmite Microbial Communities From Echo Passage, Kartchner Caverns, Arizona, Usa

Source Dataset Sampling Location
Location Name2980 Arizona 90, Benson, AZ 85602, United States
CoordinatesLat. (o)31.837801Long. (o)-110.350292Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002666Metagenome / Metatranscriptome539Y

Sequences

Protein IDFamilyRBSSequence
Ga0064592_11766503F002666AGGAMRRFGRQCRGQGKVFVTLVRQTEKQLLETGQPVLPLAQAAQACVQSAAHLAEDQRARLATTLTAALAAHHQIATQSRRLTTGKPLTQCKIVNAYDPTIAPICKGKSNCPTQFGRKPGIIAEPASGFIFAFQLPVGNPSDASYVMPLVDKVQHALGRVASRPTLAIHSLAGDLALNDPTVRQTLHARGILTVGIPHTVEPLPPSPTPAEVRQMLTAAGLHSKRTPHQVQLACACGYSRPVIESIIASLLCRGAARISYKGHRGAIIHTGMAIMAHNAATLVRIHQQQLSKRAQKFRRLLRLKHHNVNQFKVSKN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.