NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0064592_1278532

Scaffold Ga0064592_1278532


Overview

Basic Information
Taxon OID3300004454 Open in IMG/M
Scaffold IDGa0064592_1278532 Open in IMG/M
Source Dataset NameStalagmite microbial communities from Echo Passage, Kartchner Caverns, Arizona, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)506
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Stalagmite → Stalagmite Microbial Communities From Echo Passage, Kartchner Caverns, Arizona, Usa

Source Dataset Sampling Location
Location Name2980 Arizona 90, Benson, AZ 85602, United States
CoordinatesLat. (o)31.837801Long. (o)-110.350292Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015813Metagenome / Metatranscriptome252Y

Sequences

Protein IDFamilyRBSSequence
Ga0064592_12785321F015813N/AKTMTTLSHTLRAKCRKALLAGVALSVLLTPTFARSAEREGSVLFFSLEDLQQVLSHPSLPSFSQLLPSFEWRERPEAGEQDGRLERNSRWGNGLGIDGYTRPGTRPLWGY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.