Basic Information | |
---|---|
Taxon OID | 3300004454 Open in IMG/M |
Scaffold ID | Ga0064592_1278532 Open in IMG/M |
Source Dataset Name | Stalagmite microbial communities from Echo Passage, Kartchner Caverns, Arizona, USA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 506 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Stalagmite → Stalagmite Microbial Communities From Echo Passage, Kartchner Caverns, Arizona, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | 2980 Arizona 90, Benson, AZ 85602, United States | |||||||
Coordinates | Lat. (o) | 31.837801 | Long. (o) | -110.350292 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015813 | Metagenome / Metatranscriptome | 252 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0064592_12785321 | F015813 | N/A | KTMTTLSHTLRAKCRKALLAGVALSVLLTPTFARSAEREGSVLFFSLEDLQQVLSHPSLPSFSQLLPSFEWRERPEAGEQDGRLERNSRWGNGLGIDGYTRPGTRPLWGY* |
⦗Top⦘ |