 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300004460 Open in IMG/M |
| Scaffold ID | Ga0066222_1001790 Open in IMG/M |
| Source Dataset Name | Marine viral communities from Newfoundland, Canada BC-1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Yale University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 10303 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (78.57%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Viral Communities From Newfoundland, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Newfoundland, Canada | |||||||
| Coordinates | Lat. (o) | 47.593411 | Long. (o) | -52.885466 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052627 | Metagenome / Metatranscriptome | 142 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066222_10017909 | F052627 | AGG | MSKRSSLITQITTNIAAHSNVSISSDLPYDSAGDPLYEKNMNVIYVGEQDIDVEELYGTLDQNPVFQTTTSIPVYLSTDAKVQFDDIETIVANLLIARSTITGTIESDSSYETEISEDVITYSFEYNFITV* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |