Scaffold Ga0063356_100197578

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0063356_100197578

Scaffold Ga0063356_100197578

Overview

Basic Information
Taxon OID	3300004463 Open in IMG/M
Scaffold ID	Ga0063356_100197578 Open in IMG/M
Source Dataset Name	Combined assembly of Arabidopsis thaliana microbial communities
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2367
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere → Arabidopsis Thaliana Rhizosphere Microbial Communities From The Joint Genome Institute, Usa, That Affect Carbon Cycling

Source Dataset Sampling Location
Location Name	USA: Walnut Creek, California
Coordinates	Lat. (^o)	37.931388	Long. (^o)	-122.021761	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043319	Metagenome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063356_1001975783	F043319	N/A	MTKFKEIMIGTMMPAIKAIGKAEMEAVLSGIKEHNTAEIYRTTLQGLHSNFSLLRDAAYKTKSKIDDGIVDLVLEAVKESADKGGIVLS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.