Basic Information | |
---|---|
Taxon OID | 3300004481 Open in IMG/M |
Scaffold ID | Ga0069718_15528364 Open in IMG/M |
Source Dataset Name | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | The National High-throughput DNA Sequencing Centre |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4600 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (42.86%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Urban Pond Sediment Microbial Communities From Copenhagen, Denmark |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Copenhagen, Denmark | |||||||
Coordinates | Lat. (o) | 55.685937 | Long. (o) | 12.574205 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067892 | Metagenome / Metatranscriptome | 125 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0069718_155283642 | F067892 | AGGAG | MTEGQSQIKIDKSNLLKAGKIPVIAAAIGGALWLLGFLGGLMGILFWVVAAFAGYWYVGLALKSEPKPSIVEVIVNGAILGAAVGLVYAVVTWIAISVRYSGIAAGLVSYSWGFGAIIRIVLEGGIGGAIGAAGWYAFKTGMIKTK* |
⦗Top⦘ |