Scaffold Ga0069718_15528364

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0069718_15528364

Scaffold Ga0069718_15528364

Overview

Basic Information
Taxon OID	3300004481 Open in IMG/M
Scaffold ID	Ga0069718_15528364 Open in IMG/M
Source Dataset Name	Combined Assembly of Gp0112041, Gp0112042, Gp0112043
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	The National High-throughput DNA Sequencing Centre
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4600
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (42.86%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Urban Pond Sediment Microbial Communities From Copenhagen, Denmark

Source Dataset Sampling Location
Location Name	Copenhagen, Denmark
Coordinates	Lat. (^o)	55.685937	Long. (^o)	12.574205	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067892	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0069718_155283642	F067892	AGGAG	MTEGQSQIKIDKSNLLKAGKIPVIAAAIGGALWLLGFLGGLMGILFWVVAAFAGYWYVGLALKSEPKPSIVEVIVNGAILGAAVGLVYAVVTWIAISVRYSGIAAGLVSYSWGFGAIIRIVLEGGIGGAIGAAGWYAFKTGMIKTK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.