NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0007791_10002884

Scaffold Ga0007791_10002884


Overview

Basic Information
Taxon OID3300004772 Open in IMG/M
Scaffold IDGa0007791_10002884 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6438
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003962Metagenome / Metatranscriptome459Y
F004010Metagenome / Metatranscriptome457Y
F019450Metagenome / Metatranscriptome229Y

Sequences

Protein IDFamilyRBSSequence
Ga0007791_1000288411F019450GAGGMTSYAVYNSVGQFQARFLTWRSALRWAIREGMEWTAVIRKEVGE*
Ga0007791_100028843F004010AGGAGMLGKDVSKNMHELVMDNKKKGKERGAGGTPRSRQQMIAIALSAAGKSNKSPRKFRMRSGS
Ga0007791_100028848F003962AGAAGGLNHDREQLKVAHKFIALLQRENAQLHGVLRLLGQLVDDMNANCSYEVFEVQWNSLTEQVKRLSGFFESHQKALQSLQDSIPDVWDQDEVDDLES*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.