NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0007792_10015479

Scaffold Ga0007792_10015479


Overview

Basic Information
Taxon OID3300004805 Open in IMG/M
Scaffold IDGa0007792_10015479 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2332
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000934Metagenome / Metatranscriptome828Y
F010469Metagenome / Metatranscriptome303Y

Sequences

Protein IDFamilyRBSSequence
Ga0007792_100154792F000934GAGMSLNQILAISEAVGINDHRFIGTMISRNQRISTSEIMTVVPFNFDMKPMNYLLYSQNRALLNSLRIPDMALEQYLNFGTTGWVNYIAYQGDMTSGQLATCQYQTSTIMGTKNIILGSLPSISSTLYVVKQGDFLQIDRYAYIATADVLRGSGTTVTIPVHRNILTQLTSVQNAVIGQYGTTISLGGSTYTGITFCVILRAYPTYTLMPITNDSFIQWSGAFTAFENVLP*
Ga0007792_100154793F010469N/AMNNITPVQNTNNIRIADFVRVTTPTATYRFSTAPTALTISAVDSVPFSAVGSLVSIGNVQRDIKSTGNDTTVTFIGLDTALLGWVLSQNLKGSQIEMWHGFFNTDGTLITTGGTGGLYQFFNGYIHAFAISEQWMEQVRQFVGTITITAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.