NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0007792_10029555

Scaffold Ga0007792_10029555


Overview

Basic Information
Taxon OID3300004805 Open in IMG/M
Scaffold IDGa0007792_10029555 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1662
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067520Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0007792_100295552F067520AGGAGMANADAVGQNTPDSFGNFAIAGVTGASLATAGNAVVAIPFLKGGLTNSGNLTGSGQVIIRRVTVQNPNTSVSLANVSICTSNDGNATNAVVSTVSLANLTAVNKFQDLAVASPYALTTTVNGANTSALYLNVSNAAAGIVDIRVYGDTVSF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.