Basic Information | |
---|---|
Taxon OID | 3300004822 Open in IMG/M |
Scaffold ID | Ga0070913_101130 Open in IMG/M |
Source Dataset Name | Hypersaline lake viral communities from Bras del Port, Santa Pola, Alicante, Spain - CR30 Febr14 dirigido |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Alicante |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 958 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Hypersaline Lake → Hypersaline Lake Viral Communities From Bras Del Port, Santa Pola, Alicante, Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bras del Port, Alicante. | |||||||
Coordinates | Lat. (o) | 38.19317 | Long. (o) | -0.59268 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F054456 | Metagenome | 140 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0070913_1011302 | F054456 | N/A | MYEPDLDFETDTEELTPAQAHDRWEDVTNLDTPELERLEDSRRNELYLDAAEGNQGDDNPPIPGGPLADAQHLASTPRDEWGPDERAEAEEAFNFLSRTLAQFDQSEGEALIEEEPPKIHKDELSIMRWGVDPKPSDDFL* |
⦗Top⦘ |