NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0069134_166968

Scaffold Ga0069134_166968


Overview

Basic Information
Taxon OID3300004831 Open in IMG/M
Scaffold IDGa0069134_166968 Open in IMG/M
Source Dataset NameMarine surface microbial communities from the North Atlantic Ocean - filtered matter
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)810
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater → Marine Surface Microbial Communities From The North Atlantic Ocean, Enriched With Methanesulfonate

Source Dataset Sampling Location
Location NameLeca da Palmeira, Matosinhos
CoordinatesLat. (o)41.226956Long. (o)-8.720528Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012353Metagenome / Metatranscriptome281N
F034958Metagenome / Metatranscriptome173Y

Sequences

Protein IDFamilyRBSSequence
Ga0069134_1669681F012353N/AMGRWVFVYEIDNIPDMKKLMLYTTGEWKVDPNKDITFPLVRWLFKLFPILDGSEIEINQVDLGDECAYGFCQEDDGEFLIHVHNHMDLKEYVKTLIHEITHVRQTLDGITDSNAREDEAYYLEDQLSKAFWDSNISGT*
Ga0069134_1669682F034958AGGAMKKSKVDQMIDNLEVCIDFLGLDDERTGEMLAATNELGVNVEYFCHEFMETSSRELHNPDYLNIAEFNATFWEF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.