NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0069134_168305

Scaffold Ga0069134_168305


Overview

Basic Information
Taxon OID3300004831 Open in IMG/M
Scaffold IDGa0069134_168305 Open in IMG/M
Source Dataset NameMarine surface microbial communities from the North Atlantic Ocean - filtered matter
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1436
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater → Marine Surface Microbial Communities From The North Atlantic Ocean, Enriched With Methanesulfonate

Source Dataset Sampling Location
Location NameLeca da Palmeira, Matosinhos
CoordinatesLat. (o)41.226956Long. (o)-8.720528Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079198Metagenome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0069134_1683054F079198N/AMDDLIEQQLDKIAKDLGSKVDHFTCYDSNSTWNKIVIKYNHKLKED*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.