Scaffold Ga0031678_180790

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0031678_180790

Scaffold Ga0031678_180790

Overview

Basic Information
Taxon OID	3300004959 Open in IMG/M
Scaffold ID	Ga0031678_180790 Open in IMG/M
Source Dataset Name	Metatranscriptome of deep ocean microbial communities from Blanes Bay, Balearic Sea - MPBL130115 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	837
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	Blanes Bay
Coordinates	Lat. (^o)	41.67	Long. (^o)	2.8	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009123	Metagenome / Metatranscriptome	322	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0031678_1807901	F009123	N/A	SKLTMLSIVGLSATANNAEVTTSNLRSGAAFDNLKASWGKKLSLGDFSSQLDCSYDYNANRDFLKSASLSGNLVDGSGDDLSVGYEVTKNFAGDKTTEVKLTADMSGTRLTAEMDTADQLKEVSAARTVSIGDRDVDLEPSFLVKAQTARVKLMSAFGKDRASAQVDYKTEGGDISYELGYERDLQDGRQVSATLTPADKNLDVELVDTKFESGATWTAKASVPLEADNVLDAAKVTLKRAWNW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.